missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
NDE1 Polyclonal antibody specifically detects NDE1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Especificaciones
Especificaciones
| Antígeno | NDE1 |
| Aplicaciones | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulación | PBS (pH 7.3), 50% glycerol |
| Alias de gen | FLJ20101, HOM-TES-87, nuclear distribution protein nudE homolog 1, NudE, nudE nuclear distribution gene E homolog 1 (A. nidulans), NUDE1, rat homolog |
| Especie del huésped | Rabbit |
| Inmunógeno | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human NDE1 (NP_060138.1).,, Sequence:, MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQL |
| Método de purificación | Affinity purified |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?