missing translation for 'onlineSavingsMsg'
Learn More
Learn More
N-PAC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Especificaciones
| Antígeno | N-PAC |
|---|---|
| Aplicaciones | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Especie del huésped | Rabbit |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18665865
|
Novus Biologicals
NBP2-38576-25ul |
25 μL |
415.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18140669
|
Novus Biologicals
NBP2-38576 |
0.1 mL |
624.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
N-PAC Polyclonal specifically detects N-PAC in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Especificaciones
| N-PAC | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q49A26 | |
| 84656 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: IVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQLKPYHAHKEEMIKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHNSSD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| BM045, Cytokine-like nuclear factor N-PAC, Glyoxylate reductase 1 homolog, glyoxylate reductase 1 homolog (Arabidopsis), HIBDLnuclear protein 60 kDa, NP603-hydroxyisobutyrate dehydrogenase-like protein, N-PAC, nuclear protein 60kDa, Nuclear protein NP60, Nuclear protein of 60 kDa, putative oxidoreductase GLYR1 | |
| GLYR1 | |
| IgG | |
| Affinity Purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto