missing translation for 'onlineSavingsMsg'
Learn More

N-Cadherin Antibody, Novus Biologicals™

Código de producto. 18616405 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18616405 25 μL 25 microlitros
18096404 0.1 mL 0.10 ml
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18616405

Marca: Novus Biologicals NBP23885625ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody has been used in 4 publications

N-Cadherin Polyclonal specifically detects N-Cadherin in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifikationer

Antígeno N-Cadherin
Aplicaciones Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N.º de referencia del gen P19022
Alias de gen cadherin 2, N-cadherin (neuronal), cadherin 2, type 1, N-cadherin (neuronal), cadherin-2, CD325, CD325 antigen, CDHNcalcium-dependent adhesion protein, neuronal, CDw325, N-cadherin, NCADN-cadherin 1, Neural cadherin, neural-cadherin
Símbolos de los genes CDH2
Especie del huésped Rabbit
Inmunógeno This N-Cadherin Antibody was developed against a recombinant protein corresponding to amino acids: NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP
Peso molecular del antígeno 100 kDa
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Cancer, Cell Cycle and Replication, Cellular Markers, Extracellular Matrix, Mesenchymal Stem Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction, Stem Cells
Primario o secundario Primary
ID de gen (Entrez) 1000
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.