missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ MTNR1A (Human) Recombinant Protein
Human MTNR1A partial ORF ( NP_005949, 296 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00004543-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
- Sequence: GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV
Especificaciones
| NP_005949 | |
| melatonin receptor 1A | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MTNR1A | |
| GST |
| 4543 | |
| Wheat germ expression system | |
| 25 μg | |
| MEL-1A-R, MT1 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |