missing translation for 'onlineSavingsMsg'
Learn More

MT-CO2 Antibody - BSA Free, Novus Biologicals™

Código de producto. 18657712 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.02 mL
0.1 mL
Tamaño de la unidad:
0.02 ml
0.10 ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18657712 0.1 mL 0.10 ml
18675632 0.02 mL 0.02 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18657712 Proveedor Novus Biologicals N.º de proveedor NBP2943640.1ml

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

MT-CO2 Polyclonal antibody specifically detects MT-CO2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno MT-CO2
Aplicaciones Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:500-1:2000, Immunohistochemistry 1:100 - 1:500, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.3), 50% glycerol
Alias de gen COII, COX2, COXII, Cytochrome C Oxidase II, Cytochrome C Oxidase Polypeptide II, Cytochrome C Oxidase Subunit II, EC 1.9.3.1, Mitochondrially Encoded Cytochrome C Oxidase II, MTCO2
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence within amino acids 101-200 of mouse MT-CO2 (NP_904331.1). GHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEIC
Método de purificación Affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 4513
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.