missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. MT-CO2 Antibody - Azide and BSA Free, Novus Biologicals™

MT-CO2 Antibody - Azide and BSA Free, Novus Biologicals™

Código de producto. p-200061121 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.02 mL
0.1 mL
Tamaño de la unidad:
0.02 ml
0.10 ml
Código de producto. Cantidad unitSize
18666160 0.02 mL 0.02 ml
18643470 0.1 mL 0.10 ml
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18666160

Marque: Novus Biologicals NBP2930840.02ml

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

MT-CO2 Polyclonal antibody specifically detects MT-CO2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spécification

Antígeno MT-CO2
Aplicaciones Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:1000 - 1:5000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.3), 50% glycerol
Alias de gen COII, COX2, COXII, Cytochrome C Oxidase II, Cytochrome C Oxidase Polypeptide II, Cytochrome C Oxidase Subunit II, EC 1.9.3.1, Mitochondrially Encoded Cytochrome C Oxidase II, MTCO2
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence within amino acids 40-100 of human MT-CO2 (YP_003024029.1). YALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSI
Método de purificación Affinity purified
Cantidad 0.02 mL
Estado normativo RUO
Disciplina de investigación Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 4513
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.