Abnova™ MRPS12 Recombinant Protein

Name: Abnova&trade; MRPS12 Recombinant Protein
Brand: Abnova&trade;
SKU: 16120332
Price: 335.00 EUR

Marca: Abnova™ H00006183-P01.10ug

Detalles adicionales : Peso : 0.00010kg

Código de producto. 16120332

Fecha estimada de envío: 31-05-2024
para ver el stock

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Número de acceso	AAH01617
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecular	40.92
Intervalo de pH	8
Método de purificación	Glutathione Sepharose 4 Fast Flow
Cantidad	10 ug
Inmunógeno	MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK
Alias de gen	MPR-S12/MT-RPS12/RPMS12/RPS12/RPSM12
Símbolo de gen	MRPS12
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST

Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
ID de gen (Entrez)	6183
Nombre	MRPS12 (Human) Recombinant Protein (P01)
Método de preparación	In vitro wheat germ expression system
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Fuente	Wheat Germ (in vitro)
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nombre común	MRPS12
Reactividad cruzada	Human
Recombinante	Recombinant
Formulario	Solution

Product Suggestions

Description