missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ MRPS12 Recombinant Protein
Marca: Abnova™ H00006183-P01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
AAH01617 | |
Solution | |
6183 | |
MRPS12 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MRPS12 | |
Human | |
Yes |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
40.92 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK | |
MPR-S12/MT-RPS12/RPMS12/RPS12/RPSM12 | |
MRPS12 | |
Wheat Germ (in vitro) | |
GST |