missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. MPRA Antibody, Novus Biologicals™

MPRA Antibody, Novus Biologicals™

Código de producto. 18765313 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25ul
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18765313 0.1 mL 0.10 ml
18414932 25ul 25 microlitros
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18765313

Marca: Novus Biologicals NBP213731

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Beschreibung

Rabbit Polyclonal Antibody

MPRA Polyclonal specifically detects MPRA in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spezifikation

Antígeno MPRA
Aplicaciones Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen membrane progestin receptor alpha, mPR alpha, MPRA2310021M12Rik, MRPA, mSR, Progestin and adipoQ receptor family member 7, progestin and adipoQ receptor family member VIIPGLP
Símbolos de los genes PAQR7
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to the amino acids: MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEA
Método de purificación Affinity Purified
Cantidad 0.1 mL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 164091
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.