missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Motilin Antibody - BSA Free, Novus Biologicals™

Motilin Antibody - BSA Free, Novus Biologicals™

Product Code. p-200063520 Shop All Bio Techne Products
Change view
Click to view available options
Cantidad:
0.02 mL
0.1 mL
Unit Size:
0.02 ml
0.10 ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Cantidad unitSize
18677041 0.02 mL 0.02 ml
18695760 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18677041 Supplier Novus Biologicals Supplier No. NBP2938680.02ml

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Motilin Polyclonal antibody specifically detects Motilin in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antígeno Motilin
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:100, Immunohistochemistry-Paraffin
Formulación PBS (pH 7.3), 50% glycerol
Alias de gen MGC138519, motilin, prepromotilin, promotilin
Especie del huésped Rabbit
Inmunógeno Recombinant fusion protein containing a sequence corresponding to amino acids 26-115 of human MLN (NP_002409.1). FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK
Método de purificación Affinity purified
Cantidad 0.02 mL
Estado normativo RUO
Disciplina de investigación Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 4295
Especies diana Human, Mouse
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.