missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MLL3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-57730
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
MLL3 Polyclonal specifically detects MLL3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
| MLL3 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| ALR-like protein, DKFZp686C08112, EC 2.1.1.43, FLJ12625, HALRMGC119851, histone-lysine N-methyltransferase MLL3, histone-lysine N-methyltransferase, H3 lysine-4 specific, Homologous to ALR protein, KIAA1506FLJ38309, KMT2C, KMT2CMGC119852, Lysine N-methyltransferase 2C, MGC119853, myeloid/lymphoid or mixed-lineage leukemia 3, Myeloid/lymphoid or mixed-lineage leukemia protein 3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 58508 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| KMT2C | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TPPTMSQPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQ | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido