missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Mer Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-58025
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Mer Polyclonal specifically detects Mer in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
| Mer | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| c-mer, c-mer proto-oncogene tyrosine kinase, EC 2.7.10, EC 2.7.10.1, MER, MER receptor tyrosine kinase, MGC133349, Receptor tyrosine kinase MerTK, RP38Proto-oncogene c-Mer, STK kinase, tyrosine-protein kinase Mer | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| MERTK | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA | |
| 100 μL | |
| Cancer, Protein Kinase, Signal Transduction, Vision | |
| 10461 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion