missing translation for 'onlineSavingsMsg'
Learn More

Mcl-1 Antibody (CL1128), Novus Biologicals™

Código de producto. 18675458 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18675458 25 μL 25 microlitros
18624818 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18675458 Proveedor Novus Biologicals N.º de proveedor NBP25296825ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Mouse Monoclonal Antibody

Mcl-1 Monoclonal antibody specifically detects Mcl-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Mcl-1
Aplicaciones Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación Monoclonal
Clon CL1128
Conjugado Unconjugated
Dilución Western Blot 1 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulación PBS (pH 7.2), 40% Glycerol
Alias de gen bcl2-L-3, BCL2L3MGC104264, Bcl-2-like protein 3, Bcl-2-related protein EAT/mcl1, EAT, induced myeloid leukemia cell differentiation protein Mcl-1, Mcl-1, mcl1/EAT, MCL1-ES, MCL1L, MCL1S, MGC1839, myeloid cell leukemia ES, myeloid cell leukemia sequence 1 (BCL2-related), TM
Especie del huésped Mouse
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG
Método de purificación Protein A purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Apoptosis, Cancer, Signal Transduction, Tumor Suppressors
Primario o secundario Primary
ID de gen (Entrez) 4170
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG1
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.