missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ MCFD2 Recombinant Protein Código de producto.: 16156493
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. Abnova™ MCFD2 Recombinant Protein

Abnova™ MCFD2 Recombinant Protein

Código de producto. p-3720072
10 μg, 10 microgramos
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16156493

Marca: Abnova™ H00090411P01.10ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso AAH40357
Para utilizar con (aplicación) Antibody Production, Protein Array, ELISA, Western Blot
Formulación 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID de gen (Entrez) 90411
Peso molecular 41.8
Nombre MCFD2 (Human) Recombinant Protein (P01)
Intervalo de pH 8
Método de preparación In vitro wheat germ expression system
Método de purificación Glutathione Sepharose 4 Fast Flow
Pruebas de control de calidad 12.5% SDS-PAGE Stained with Coomassie Blue.
Cantidad 10 μg
Fuente Wheat Germ (in vitro)
Inmunógeno MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen DKFZp686G21263/F5F8D/LMAN1IP/SDNSF
Nombre común MCFD2
Símbolo de gen MCFD2
Reactividad cruzada Human
Especie Wheat Germ (in vitro)
Recombinante Recombinant
Etiqueta de proteína GST
Formulario Solution
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ MCFD2 Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.