Learn More
Abnova™ MAP2K5 Recombinant Protein
Descripción
The encoded protein is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, as well as by atypical protein kinase C isoforms (aPKCs).
- Human MAP2K5 full-length ORF ( AAH08838, 1 a.a. - 448 a.a.) recombinant protein with GST-tag at N-terminal
- Description: mitogen-activated protein kinase 5
- Theoretical molecular weight: 75.02kDa
- Preparation: in vitro wheat germ expression system
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer
Sequence: MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYH VPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGESSEPFVHFITQCMRKQPKERPAPEELMGHPFIVQFNDGNAAVVSMWVCRALEERRSQQGPP
Best use within three months from the date of receipt.
ELISA, western blotting (recombinant protein), antibody production, protein array
Especificaciones
Especificaciones
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Peso molecular | 75.02 |
| Nombre | Human MAP2K5 Full-length ORF Recombinant Protein with GST-tag at N-terminal |
| Intervalo de pH | 8 |
| Método de preparación | In vitro wheat germ expression system |
| Método de purificación | Glutathione Sepharose 4 Fast Flow |
| Pruebas de control de calidad | 12.5% SDS-PAGE stained with Coomassie Blue |
| Cantidad | 25 μg |
| Fuente | Wheat Germ (in vitro) |
| Mostrar más |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.