missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LLPH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65€ - 590.10€
Especificaciones
| Antígeno | LLPH |
|---|---|
| Aplicaciones | Immunocytochemistry, Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Especie del huésped | Rabbit |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18107619
|
Novus Biologicals
NBP2-54933 |
100 μL |
 624.00€ 590.10€ / 100 microlitros Ahorro 33.90€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18624327
|
Novus Biologicals
NBP2-54933-25ul |
25 μL |
415.00€ 391.65€ / 25 microlitros Ahorro 23.35€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
LLPH Polyclonal specifically detects LLPH in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Especificaciones
| LLPH | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C12orf31, Chromosome 12 Open Reading Frame 31, CPERP-G, HLLP, Human LAPS18-Like Protein, LLP Homolog, Long-Term Synaptic Facilitation, LLP Homolog, Long-Term Synaptic Facilitation (Aplysia), Protein LAPS18-Like, Protein LLP Homolog | |
| LLPH | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 84298 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KMQCEVKDEKDDMKMETDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.