missing translation for 'onlineSavingsMsg'
Learn More

LIMPII/SR-B2 Antibody, Novus Biologicals™

Código de producto. 18239757 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Unit Size:
0.10 ml
25 microlitros
Product Code. Cantidad unitSize
18239757 0.1 mL 0.10 ml
18486140 25 μL 25 microlitros
2 options
This item is not returnable. View return policy

Product Code. 18239757

Brand: Novus Biologicals NBP184583

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

LIMPII/SR-B2 Polyclonal specifically detects LIMPII/SR-B2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno LIMPII/SR-B2
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen AMRF, CD36 antigen, CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2(lysosomal integral membrane protein II), CD36L2LIMP II, HLGP85, LGP85, LIMP-2,85 kDa lysosomal sialoglycoprotein scavenger receptor class B, member 2, LIMPIICD36 antigen-like 2, lysosome membrane protein 2, Lysosome membrane protein II, Scavenger receptor class B member 2,85 kDa lysosomal membrane sialoglycoprotein, scavenger receptor class B, member 2, SR-BII
Símbolos de los genes SCARB2
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:SFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGD
Método de purificación Affinity Purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Cellular Markers, Cholesterol Metabolism, Lipid and Metabolism, Lysosome Markers, Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 950
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.