missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Lgr5/GPR49 Antibody, Novus Biologicals™

Lgr5/GPR49 Antibody, Novus Biologicals™

Código de producto. p-200073903 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
25 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18227950 100 μL 100 microlitros
18675026 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18227950 Proveedor Novus Biologicals N.º de proveedor NBP254660

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Description

Rabbit Polyclonal Antibody

Lgr5/GPR49 Polyclonal specifically detects Lgr5/GPR49 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno Lgr5/GPR49
Aplicaciones Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry-Paraffin 1:200 - 1:500
Formulación PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gen FEX, G protein-coupled receptor 49, GPR49G-protein coupled receptor HG38, GPR67, G-protein coupled receptor 49, G-protein coupled receptor 67, GRP49, HG38, leucine-rich repeat containing G protein-coupled receptor 5, leucine-rich repeat-containing G protein-coupled receptor 5, leucine-rich repeat-containing G-protein coupled receptor 5, MGC117008, orphan G protein-coupled receptor HG38
Símbolos de los genes LGR5
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a Recombinant Protein corresponding to amino acids:AIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG
Método de purificación Affinity Purified
Cantidad 100 μL
Estado normativo RUO
Disciplina de investigación Cancer, GPCR, Neuroscience, Signal Transduction, Wnt Signaling Pathway
Primario o secundario Primary
ID de gen (Entrez) 8549
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.