missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beskrivelse
LAPTM5 Polyclonal specifically detects LAPTM5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Tekniske data
Tekniske data
| Antígeno | LAPTM5 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gen | CD40-ligand-activated specific transcripts, CLAST6, FLJ61683, FLJ97251, human retinoic acid-inducible E3 protein, KIAA0085, lysosomal associated multispanning membrane protein 5, lysosomal multispanning membrane protein 5, lysosomal protein transmembrane 5, Lysosomal-associated multitransmembrane protein 5, lysosomal-associated transmembrane protein 5, MGC125860, MGC125861, Retinoic acid-inducible E3 protein |
| Símbolos de los genes | LAPTM5 |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against Recombinant Protein corresponding to amino acids: IKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTP |
| Vis mere |
For Research Use Only
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?