Abnova™ KLRD1 (Human) Recombinant Protein

Human KLRD1 full-length ORF ( AAH28009, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.

Marca: Abnova™ H00003824-P01.25ug

Código de producto. 16167161

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Sequence: MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSRQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI

Especificaciones

Número de acceso	AAH28009
Nombre	killer cell lectin-like receptor subfamily D, member 1
Pruebas de control de calidad	125% SDS-PAGE Stained with Coomassie Blue
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Símbolo de gen	KLRD1
Etiqueta de proteína	GST

ID de gen (Entrez)	3824
Método de preparación	Wheat germ expression system
Cantidad	25 μg
Alias de gen	CD94
Especie	Wheat Germ (in vitro)
Tampón	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Sugerencias de productos

Descripción