missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. KCC2/SLC12A5 Antibody, Novus Biologicals™

KCC2/SLC12A5 Antibody, Novus Biologicals™

Código de producto. 18634458 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18634458 0.1 mL 0.10 ml
18610749 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18634458 Proveedor Novus Biologicals N.º de proveedor NBP249674

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

KCC2/SLC12A5 Polyclonal antibody specifically detects KCC2/SLC12A5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno KCC2/SLC12A5
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Formulación PBS (pH 7.2), 40% Glycerol
Alias de gen Electroneutral potassium-chloride cotransporter 2, hKCC2, KCC2K-Cl cotransporter 2, KIAA1176erythroid K-Cl cotransporter 2, Neuronal K-Cl cotransporter, solute carrier family 12 (potassium/chloride transporter), member 5, solute carrier family 12 member 5
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSC
Método de purificación Immunogen affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Potassium Channels
Primario o secundario Primary
ID de gen (Entrez) 57468
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.