missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Karyopherin (importin) beta 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-38480
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Karyopherin (importin) beta 3 Polyclonal specifically detects Karyopherin (importin) beta 3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| Karyopherin (importin) beta 3 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| O00410 | |
| IPO5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DKFZp686O1576, FLJ43041, IMB3, imp5, importin 5, importin beta-3 subunit, Importin subunit beta-3, importin-5, karyopherin (importin) beta 3, Karyopherin beta-3, KPNB3, MGC2068, RAN binding protein 5, Ran_GTP binding protein 5, Ran-binding protein 5, RANBP5 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 3843 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido