missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Junctional Cadherin Complex Regulator Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 560.70€
Especificaciones
| Antígeno | Junctional Cadherin Complex Regulator |
|---|---|
| Dilución | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18630659
|
Novus Biologicals
NBP2-62719-25ul |
25 μL |
369.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18690649
|
Novus Biologicals
NBP2-62719 |
100 μg |
 593.00€ 560.70€ / 100 microlitros Ahorro 32.30€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
Junctional Cadherin Complex Regulator Polyclonal antibody specifically detects Junctional Cadherin Complex Regulator in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Especificaciones
| Junctional Cadherin Complex Regulator | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| C11orf63, chromosome 11 open reading frame 63 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YAKQVKEYNMKTLSILSKPQTEKTQKKSAIPRQKALEYAKTIPKPKPSNLTHQASKEQKNPTYAGKEESLPEISLLEI | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 79864 | |
| IgG | |
| Protein A purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto