missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Junctional Cadherin Complex Regulator Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-62719
Código de producto. 18690649
-
593.00€
560.70€ / 100 microlitros
Ahorro 32.30€
5% Descuento
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Junctional Cadherin Complex Regulator Polyclonal antibody specifically detects Junctional Cadherin Complex Regulator in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
| Junctional Cadherin Complex Regulator | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| C11orf63, chromosome 11 open reading frame 63 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YAKQVKEYNMKTLSILSKPQTEKTQKKSAIPRQKALEYAKTIPKPKPSNLTHQASKEQKNPTYAGKEESLPEISLLEI | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 79864 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido