missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. ITIH4 Antibody (CL1858), Novus Biologicals™

ITIH4 Antibody (CL1858), Novus Biologicals™

Código de producto. 18427221 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18427221 25 μL 25 microlitros
18152704 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18427221 Proveedor Novus Biologicals N.º de proveedor NBP23449225ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Mouse Monoclonal Antibody has been used in 1 publication

ITIH4 Monoclonal specifically detects ITIH4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno ITIH4
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clasificación Monoclonal
Clon CL1858
Conjugado Unconjugated
Dilución Western Blot 1 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000, Immunohistochemistry-Frozen
N.º de referencia del gen Q14624
Alias de gen DKFZp686G21125, H4P, heavy chain-like, 1, IHRP, inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein), inter-alpha-trypsin inhibitor family heavy chain-related protein, inter-alpha-trypsin inhibitor heavy chain H4, ITI-HC4, ITIHL1, PK-120, plasma kallikrein-sensitive glycoprotein 120, PRO1851
Símbolos de los genes ITIH4
Especie del huésped Mouse
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: LAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESRNRNVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPA
Método de purificación Protein A purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 3700
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG1
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.