missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Reactivos bioquímicos
  4. Péptidos
  5. 18247429

Novus Biologicals™ IL-22BP/IL22 RA2 Recombinant Protein Antigen

Código de producto. 18247429 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0,1 mL
Tamaño de la unidad:
0.10 ml
Código de producto. Cantidad unitSize
18247429 0,1 mL 0.10 ml
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18247429

Marca: Novus Biologicals™ NBP185455PEP

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL22RA2. The IL-22BP/IL22 RA2 Recombinant Protein Antigen is derived from E. coli. The IL-22BP/IL22 RA2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-85455. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifica

Gene ID (Entrez) 116379
Especie Human
Método de purificación Chromatography
Pureza >80%
Concentración 0.5mg/mL
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulación PBS and 1M Urea, pH 7.4.
Para utilizar con (aplicación) Blocking/Neutralizing, Control
Símbolo de gen IL22RA2
Tipo de etiqueta Unlabeled
Peso molecular 28kDa
Tipo de producto IL-22BP/IL22 RA2
Cantidad 0,1 mL
Estado normativo RUO
Fuente E.Coli
Reactividad específica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85455. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Inmunógeno PNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
Vedi altri risultati Mostra meno risultati

Para uso exclusivo en investigación

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.