missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IFI44 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
201.00€ - 550.00€
Especificaciones
| Antígeno | IFI44 |
|---|---|
| Dilución | Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:100 - 1:200 |
| Aplicaciones | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
30232692
|
Novus Biologicals
NBP3-38516-100ul |
100 μL |
550.00€
100 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
30230885
|
Novus Biologicals
NBP3-38516-20ul |
20 μL |
201.00€
20 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
IFI44 Polyclonal antibody specifically detects IFI44 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ImmunofluorescenceEspecificaciones
| IFI44 | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| interferon-induced protein 44, interferon-induced, hepatitis C-associated microtubular aggregate protein(44kD), MTAP44p44Microtubule-associated protein 44, P44 | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse IFI44 (NP_598632.2).,, Sequence:, FHKRKTNDFSILLDEKAVIVSSAICKMLQLTARNNVIPIQECEAFRCEELLDERKTRGIAVLHSNLLQALRDYKPYGDLVQQTRVLLLGPIGAGKSSFVNS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:100 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 10561 | |
| IgG | |
| Affinity purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto