missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30198404

Invitrogen™ Human ZIP10 (aa 519-613) Control Fragment Recombinant Protein

Código de producto. 30198404
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30198404

Marca: Invitrogen™ RP102722

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57696 (PA5-57696. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZIP10, also known as Slc39A10, is a widely expressed zinc transporter with nine transmembrane domains. Zinc is an essential ion for cells and plays significant roles in the growth, development, and differentiation. ZIP10 mRNA was found to be significantly decreased in the intestines and kidneys of hypothyroid rats and increased in those of hyperthyroid rats, indicating that ZIP10 is positively regulated by thyroid hormones. ZIP10 mRNA was also found to be upregulated in invasive and metastatic breast cancer and cell lines, suggesting that ZIP10 could serve as a possible marker for the metastatic phenotype and possibly a target for novel treatment strategies. At least three isoforms of ZIP10 are known to exist.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9ULF5
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 57181
Nombre Human ZIP10 (aa 519-613) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2900042E17Rik; 5430433I10; Kiaa1265; LZT-Hs2; mKIAA1265; Slc39a10; solute carrier family 39 (metal ion transporter), member 10; solute carrier family 39 (zinc transporter), member 10; solute carrier family 39 member 10; Zinc transporter ZIP10; ZIP10; ZIP-10; Zrt- and Irt-like protein 10
Nombre común ZIP10
Símbolo de gen SLC39A10
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia KHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGL
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado