Learn More
Invitrogen™ Human XPC (aa 843-939) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP107702
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a component of the nucleotide excision repair (NER) pathway. There are multiple components involved in the NER pathway, including Xeroderma pigmentosum (XP) A-G and V, Cockayne syndrome (CS) A and B, and trichothiodystrophy (TTD) group A, etc. This component, XPC, plays an important role in the early steps of global genome NER, especially in damage recognition, open complex formation, and repair protein complex formation. Mutations in this gene or some other NER components result in Xeroderma pigmentosum, a rare autosomal recessive disorder characterized by increased sensitivity to sunlight with the development of carcinomas at an early age. Alternatively spliced transcript variants have been found for this gene.
Especificaciones
Q01831 | |
Blocking Assay, Control | |
7508 | |
100 μL | |
DNA repair protein complementing XP-C cells; DNA repair protein complementing XP-C cells homolog; mutant xeroderma pigmentosum group C; NER; p125; RAD4; Xeroderma pigmentosum group C-complementing protein; Xeroderma pigmentosum group C-complementing protein homolog; xeroderma pigmentosum, complementation group C; XP3; XPC; XPC complex subunit, DNA damage recognition and repair factor; XPCC | |
XPC | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human XPC (aa 843-939) Control Fragment | |
RUO | |
XPC | |
Unconjugated | |
Recombinant | |
RALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEQ | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.