missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30203260

Invitrogen™ Human VLK (aa 407-487) Control Fragment Recombinant Protein

Código de producto. 30203260
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30203260 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Product Code. 30203260

Brand: Invitrogen™ RP95072

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110916 (PA5-110916. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VLK was identified as a novel protein kinase that was induced after the differentiation of cultured embryonic stem cells into mesendoderm. It has no homologs in invertebrates, but is highly conserved in vertebrate species although it does not belong to any known protein kinase groups. VLK is initially expressed in E-cadherin-positive anterior visceral endoderm and mesendoderm, but its expression is later confined to E-cadherin-negative mesenchyme. It is enriched in the Golgi apparatus and is thought to regulate the rate of protein export from the Golgi. Targeted disruption of VLK in mice leads to a defect in lung development and neonatal lethality. It has been suggested that mutations in VLK may be associated with the allergic condition atopy.
TRUSTED_SUSTAINABILITY

Specifications

Número de acceso Q504Y2
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 91461
Nombre Human VLK (aa 407-487) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Adtk1; AI115348; AW548124; ESTM17; Extracellular tyrosine-protein kinase PKDCC; MAd1; Pkdcc; protein kinase domain containing, cytoplasmic; protein kinase domain containing, cytoplasmic homolog; protein kinase domain-containing protein, cytoplasmic; Protein kinase-like protein SgK493; RGD1311939; SGK493; Sugen kinase 493; vertebrate lonesome kinase; Vlk; X83346
Nombre común VLK
Símbolo de gen PKDCC
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia TEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTT
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.