missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human VAM1 (aa 457-512) Control Fragment Recombinant Protein

Código de producto. 30202882
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30202882

Marca: Invitrogen™ RP92643

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110862 (PA5-110862. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like (see DLG1), ZO1-like (see TJP1), p55-like (see MPP1), and LIN2-like (see CASK), based on their size and the presence of additional domains. MPP6 is a member of the p55-like MAGUK subfamily (Tseng et al., 2001).
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9NZW5
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 51678
Nombre Human VAM1 (aa 457-512) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen CH474011:EDL88200; Dlgh4; Dlgh4 protein; Fibroblast growth factor-inducible protein 15; MAGUK p55 subfamily member 6; MAGUK protein p55T; membrane palmitoylated protein 6; membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 6); membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6); Mpp6; P55t; P55T protein; Pals2; protein associated with Lin7 2; protein associated with Lin-7 2; VAM1; VAM-1; VELI-associated MAGUK 1
Nombre común VAM1
Símbolo de gen MPP6
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia AAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIINDN
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado