missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30197566

Invitrogen™ Human V-ATPase E2 (aa 155-192) Control Fragment Recombinant Protein

Código de producto. 30197566
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30197566

Marca: Invitrogen™ RP101679

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62681 (PA5-62681. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q96A05
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 90423
Nombre Human V-ATPase E2 (aa 155-192) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 4930500C14Rik; Atp6e1; ATP6EL2; Atp6v1e2; ATP6V1EL2; ATPase H+ transporting V1 subunit E2; ATPase, H transporting, lysosomal V1 subunit E2; ATPase, H+ transporting, lysosomal 31 kDa, V1 subunit E2; ATPase, H+ transporting, lysosomal 31 kDa, V1 subunit E-like 2; ATPase, H+ transporting, lysosomal V1 subunit E2; ATPase, H+ transporting, V1 subunit E-like 2; E1; lysosomal 31 kDa; testis secretory sperm-binding protein Li 235 P; vacuolar proton pump subunit E 2; vacuolar-type proton-translocating ATPase subunit E1; V-ATPase subunit E 2; VMA4; V-type proton ATPase subunit E 2
Nombre común V-ATPase E2
Símbolo de gen ATP6V1E2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia YMTISQKHVEVQIDKEAYLAVNAAGGVEVYSGNQRIKV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado