missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human USP4 (aa 532-644) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP101870
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53820 (PA5-53820. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a protease that deubiquitinates target proteins such as ADORA2A and TRIM21. The encoded protein shuttles between the nucleus and cytoplasm and is involved in maintaining operational fidelity in the endoplasmic reticulum. Three transcript variants encoding different isoforms have been found for this gene.
Especificaciones
| Q13107 | |
| Blocking Assay, Control | |
| 7375 | |
| 100 μL | |
| Deubiquitinating enzyme 4; F730026I20Rik; mKIAA4155; ubiquitin carboxyl-terminal esterase 4; ubiquitin carboxyl-terminal hydrolase 4; ubiquitin specific peptidase 4; ubiquitin specific peptidase 4 (proto-oncogene); ubiquitin specific protease 4 (proto-oncogene); ubiquitin thioesterase 4; ubiquitin thiolesterase 4; ubiquitin-specific processing protease 4; ubiquitin-specific-processing protease 4; Ubiquitous nuclear protein; ubiquitous nuclear protein homolog; Unp; Unph; USP4 | |
| USP4 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human USP4 (aa 532-644) Control Fragment | |
| RUO | |
| USP4 | |
| Unconjugated | |
| Recombinant | |
| NMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human USP4 (aa 532-644) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido