missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30209503

Invitrogen™ Human UQCRC1 (aa 148-252) Control Fragment Recombinant Protein

Código de producto. 30209503
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30209503

Marca: Invitrogen™ RP102223

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82037 (PA5-82037. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UQCRC1 encodes a product that is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P31930
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 7384
Nombre Human UQCRC1 (aa 148-252) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1110032G10Rik; Complex III subunit 1; core protein I; Cytochrome b-c1 complex subunit 1, mitochondrial; D3S3191; hypothetical protein MGC73404; QCR1; ubiquinol--cytochrome c reductase; ubiquinol-cytochrome c reductase core I protein; ubiquinol-cytochrome c reductase core protein 1; ubiquinol-cytochrome c reductase core protein I; ubiquinol-cytochrome-c reductase complex core protein 1; UQCR1; Uqcrc1; UQCRC1 protein; zgc:73404; zgc:85750
Nombre común UQCRC1
Símbolo de gen Uqcrc1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado