missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TYW3 (aa 6-87) Control Fragment Recombinant Protein

Código de producto. 30197883
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30197883 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30197883

Marca: Invitrogen™ RP94393

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56221 (PA5-56221. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TYW3 is an enzyme that participates in the wybutosine-tRNA (Phe) biosynthesis pathway. Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TYW3 is involved in a multistep enzymatic reaction that stabilizes codon-anticodon base-pairing during the ribosomal decoding process, thereby ensuring correct translation.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q6IPR3
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 127253
Nombre Human TYW3 (aa 6-87) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 5230400J09Rik; C1orf171; hypothetical protein BC009514; LOC519731 protein; RGD1559623; tRNA wybutosine-synthesizing protein 3 homolog; tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase; tRNA-yW synthesizing protein 3 homolog; tRNA-yW synthesizing protein 3 homolog (S. cerevisiae); tRNA-yW-synthesizing protein 3; Tyw3
Nombre común TYW3
Símbolo de gen TYW3
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia EFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNCCWLLVTHKLCVKDDVIV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.