missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRAF4 (aa 372-468) Control Fragment Recombinant Protein

Código de producto. 30202987
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30202987

Marca: Invitrogen™ RP93179

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62595 (PA5-62595. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The tumor necrosis factor (TNF) receptor superfamily is composed of several type I integral membrane glycoproteins that exhibit homology in their cystine rich extracellular domains. Members of this family include TNF-RI, TNF-RII and CD40. Ligands for these receptors can be small, secreted proteins, such as TNF, or type II integral membrane proteins, as is the case for the CD40 ligand, CD40L. While the signal transduction mechanism of the TNF receptor superfamily is poorly understood, activation of TNF-R or CD40 have been shown to induce the nuclear translocation of NFkB. Members of the TRAF (TNF receptor-associated factor) family have been implicated in this process. Four members have thus far been described and are designated TRAF1, TRAF2, TRAF3 (variously referred to as CRAF1, LAP1 or CD40bp) and TRAF4. TRAF4, originally termed CART1, is specifically expressed in breast carcinomas, and is localized to the nucleus in such tissues.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9BUZ4
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 9618
Nombre Human TRAF4 (aa 372-468) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen A530032M13Rik; Cart1; cysteine-rich domain associated with ring and TRAF domain; cysteine-rich domain associated with RING and Traf domains protein 1; Cysteine-rich motif associated to RING and Traf domains protein 1; malignant 62; metastatic lymph node gene 62 protein; MLN 62; MLN62; msp2; RING finger protein 83; RNF83; RNF83malignant 62; TNF receptor associated factor 4; TNF receptor-associated factor 4; tnf receptor-associated factor 4 b; traf4; TRAF4 protein; TRAF4 variant 6; traf4b; tumor necrosis receptor-associated factor 4 A
Nombre común TRAF4
Símbolo de gen TRAF4
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKI
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado