Learn More
Invitrogen™ Human TMX2 (aa 132-212) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP97565
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59133 (PA5-59133. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. This protein is enriched on the mitochondria-associated-membrane of the ER via palmitoylation of two of its cytosolically exposed cysteines.
Especificaciones
Q9Y320 | |
Blocking Assay, Control | |
51075 | |
100 μL | |
2310042M24Rik; AA589631; Cell proliferation-inducing gene 26 protein; CGI-31; growth-inhibiting gene 11; My009; PDIA12; PIG26; protein disulfide isomerase family A, member 12; PSEC0045; thioredoxin domain containing 14; thioredoxin domain-containing protein 14; thioredoxin related transmembrane protein 2; thioredoxin-related transmembrane protein 2; thioredoxin-related transmembrane protein-like protein; TM x 2; TXNDC14; Unknown (protein for MGC:134152); UNQ237/PRO270 | |
TMX2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human TMX2 (aa 132-212) Control Fragment | |
RUO | |
TMX2 | |
Unconjugated | |
Recombinant | |
YMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.