missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30203437

Invitrogen™ Human TMEM184C (aa 376-437) Control Fragment Recombinant Protein

Código de producto. 30203437
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30203437 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30203437 Proveedor Invitrogen™ N.º de proveedor RP101430

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62896 (PA5-62896. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Anaplastic thyroid cancer is one of the most lethal forms of cancer, but the precise carcinogenic mechanism has not been identified. TMEM184C, also known as TMEM34, was identified in a cDNA microarray analysis as being down-regulated in anaplastic thyroid cancers compared to normal thyroid tissues. TMEM184C protein expression was also lower in cell lines derived from these types of cancers compared to that of normal thyroid tissues or cell lines based on other types of thyroid cancers. Furthermore, transfection of TMEM34 into KTA2 cells led to the inhibition of cell growth, suggesting that TMEM184C might act as a tumor suppressor in anaplastic thyroid cancers.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9NVA4
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 55751
Nombre Human TMEM184C (aa 376-437) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 8430433H16Rik; AI645453; AL033298; BC004056; DNA sequence AY228474; PRO1355; TMEM184C; Tmem34; Transmembrane protein 184 C; transmembrane protein 34
Nombre común TMEM184C
Símbolo de gen TMEM184C
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEILSDTIGEKKEPSDKSVD
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.