missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30211379

Invitrogen™ Human TM4SF1 (aa 118-165) Control Fragment Recombinant Protein

Código de producto. 30211379
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30211379 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30211379

Marca: Invitrogen™ RP101051

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51746 (PA5-51746. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TM4SF1 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains and mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TM4SF1 is a cell surface antigen and is highly expressed in the vascular endothelium of several human cancers. Knockdown experiments of TM4SF1 prevented filopodia formation, inhibited cell mobility, blocked cytokinesis, and inhibited maturation of VEGF-A-induced angiogenesis, suggesting that TM4SF1 may be an attractive target for anti-angiogenesis therapy.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P30408
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 4071
Nombre Human TM4SF1 (aa 118-165) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 12A8 target antigen; H-L6; L6; L6 antigen; M3S1; Membrane component chromosome 3 surface marker 1; membrane component chromosome 3 surface marker 1 homolog; membrane component, chromosome 3, surface marker 1; membrane component, surface marker 1; TAAL6; TM4SF1; transmembrane 4 L six family member 1; transmembrane 4 L6 family member 1; transmembrane 4 superfamily member 1; tumor-associated antigen L6
Nombre común TM4SF1
Símbolo de gen TM4SF1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSI
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.