missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30204783

Invitrogen™ Human Titin (aa 1022-1155) Control Fragment Recombinant Protein

Código de producto. 30204783
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30204783

Marca: Invitrogen™ RP89761

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52379 (PA5-52379. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Monoclonal Anti-Titin can be used for study of the elastic filaments within sarcomeric structures. It is also useful as a differentiation marker in the separation of rhabdomyosarcomas from other muscle tumors. By indirect immunofluorescence the antibody displays a typical striated staining pattern on frozen sections of chicken skeletal and cardiac muscle tissues. Stains the region of the A-I junction by indirect immunofluorescence. It shows a decoration line 0.05 mm from the end of the A band in electron micro-graphs. In immunoblotting using total extracts of chicken breast muscle the antibody reacts specifically with both bands of the titin doublet, and showed no reaction with nebulin.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q8WZ42
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 7273
Nombre Human Titin (aa 1022-1155) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1100001C23Rik; 2.7.11.1; 2310036G12Rik; 2310057K23Rik; 2310074I15Rik; AF006999; AV006427; CMD1G; CMH9; CMPD4; Connectin; connectin/titin; D330041I19Rik; D830007G01Rik; DKFZp451N061; EOMFC; FLJ26020; FLJ26409; FLJ32040; FLJ34413; FLJ39564; FLJ43066; HMERF; L56; LGMD2J; mdm; MYLK5; rhabdomyosarcoma antigen MU-RMS-40.14; shru; structural muscle protein titin; titin; titin protein homolog; titin sequence3; TMD; TTN
Nombre común Titin
Símbolo de gen TTN
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado