missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30206937

Invitrogen™ Human TIA-1 (aa 340-380) Control Fragment Recombinant Protein

Código de producto. 30206937
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30206937 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30206937 Proveedor Invitrogen™ N.º de proveedor RP106742

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Noggin is involved in numerous developmental processes, such as neural tube fusion and joint formation. The morphogenesis of organs is initiated by a downgrowth from a layer of epithelial stem cells. This process is achieved through the receipt of signals from 1) a WNT protein (WNT3A) to stabilize beta-catenin; and 2) Noggin, which is a bone morphogenetic protein inhibitor. Noggin mutations in unrelated families with proximal symphalangism (SYM1) and multiple synostoses syndrome (SYNS1) have been identified, which have multiple joint fusion as their principal defect.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P31483
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 7072
Nombre Human TIA-1 (aa 340-380) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2310050N03Rik; AI256674; cytotoxic granule-associated RNA binding protein 1; cytotoxic granule-associated RNA-binding protein 1; mTIA-1; Nucleolysin TIA-1; nucleolysin TIA-1 isoform p40; p40 TIA 1; p40-TIA-1; p40-TIA-1 (containing p15-TIA-1); RNA-binding protein TIA-1; T-cell-restricted intracellular antigen-1; Tia; TIA 1; TIA1; TIA-1; TIA1 cytotoxic granule-associated RNA binding protein; TIA1 protein; TIAL1; TIAR; WDM
Nombre común TIA-1
Símbolo de gen TIA1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia NQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.