missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Thyroglobulin (aa 1304-1466) Control Fragment Recombinant Protein

Código de producto. 30211870
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30211870 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30211870

Marca: Invitrogen™ RP100475

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82034 (PA5-82034. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The human thyroglobulin (hTg) is a high molecular weight glycoprotein (605 kDa) found in the thyroid follicular cells. It plays a central role in the uptake, incorporation, and regulated biosynthesis of thyroid hormones, T4 and T3. Thyroid disorders are, in large part, due to autoimmune origin, and anti-thyroglobulin autoantibodies were the first factor to be discovered. Anti-hTG is found in all thyroid autoimmune diseases (Hashimoto thyroiditis, Graves diseases), with the highest level observed in Hashimoto thyroiditis. Anti-hTG is also characteristic of thyroid cancer, and its determination can be used for the follow up of cancer patients.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P01266
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 7038
Nombre Human Thyroglobulin (aa 1304-1466) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AITD3; cog; Colloid; congenital goiter; hereditary goitre; TG; Tgn; thyroglobulin; thyroglobulin precursor
Nombre común Thyroglobulin
Símbolo de gen TG
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia KMCSADYADLLQTFQVFILDELTARGFCQIQVKTFGTLVSIPVCNNSSVQVGCLTRERLGVNVTWKSRLEDIPVASLPDLHDIERALVGKDLLGRFTDLIQSGSFQLHLDSKTFPAETIRFLQGDHFGTSPRTWFGCSEGFYQVLTSEASQDGLGCVKCPEGS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.