missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human Thyroglobulin (aa 1304-1466) Control Fragment Recombinant Protein Código de producto.: 30211870
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30211870

Invitrogen™ Human Thyroglobulin (aa 1304-1466) Control Fragment Recombinant Protein

Código de producto. 30211870
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30211870

Marca: Invitrogen™ RP100475

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82034 (PA5-82034. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The human thyroglobulin (hTg) is a high molecular weight glycoprotein (605 kDa) found in the thyroid follicular cells. It plays a central role in the uptake, incorporation, and regulated biosynthesis of thyroid hormones, T4 and T3. Thyroid disorders are, in large part, due to autoimmune origin, and anti-thyroglobulin autoantibodies were the first factor to be discovered. Anti-hTG is found in all thyroid autoimmune diseases (Hashimoto thyroiditis, Graves diseases), with the highest level observed in Hashimoto thyroiditis. Anti-hTG is also characteristic of thyroid cancer, and its determination can be used for the follow up of cancer patients.
TRUSTED_SUSTAINABILITY

Specifications

Número de acceso P01266
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 7038
Nombre Human Thyroglobulin (aa 1304-1466) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AITD3; cog; Colloid; congenital goiter; hereditary goitre; TG; Tgn; thyroglobulin; thyroglobulin precursor
Nombre común Thyroglobulin
Símbolo de gen TG
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia KMCSADYADLLQTFQVFILDELTARGFCQIQVKTFGTLVSIPVCNNSSVQVGCLTRERLGVNVTWKSRLEDIPVASLPDLHDIERALVGKDLLGRFTDLIQSGSFQLHLDSKTFPAETIRFLQGDHFGTSPRTWFGCSEGFYQVLTSEASQDGLGCVKCPEGS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Invitrogen™ Human Thyroglobulin (aa 1304-1466) Control Fragment Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.