missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30204410

Invitrogen™ Human Thymidine Phosphorylase (aa 21-145) Control Fragment Recombinant Protein

Código de producto. 30204410
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30204410 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30204410

Marca: Invitrogen™ RP91382

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-81876 (PA5-81876, PA5-81917 (PA5-81917. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A platelet-derived endothelial growth factor (PD-ECGF), same as thymidine phosphorylase (TP) or gliostatin. In the presence of inorganic orthophosphate, it catalyses the reversible phospholytic cleavage of thymidine and deoxyuridine to their corresponding bases and 2-deoxyribose-1-phosphate. It is both chemotactic and mitogenic for endothelial cells and a non-heparin binding angiogenic factor present in platelets. It is also involved in transformation of fluoropyrimidines, cytotoxic agents used in the treatment of a variety of malignancies, into active cytotoxic metabolites.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P19971
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 1890
Nombre Human Thymidine Phosphorylase (aa 21-145) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2900072D10Rik; ECGF; Ecgf1; endothelial cell growth factor 1 (platelet-derived); gliostatin; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; OTTHUMP00000196767; OTTHUMP00000196770; PD TP; PDECGF; PD-ECGF; Pdgfec; platelet derived growth factor, endothelial cell; Platelet-derived endothelial cell growth factor; TdRPase; thymidine phosphorylase; TP; TYMP
Nombre común Thymidine Phosphorylase
Símbolo de gen TYMP
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia EGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.