missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TGF alpha (aa 23-97) Control Fragment Recombinant Protein

Código de producto. 30196123
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30196123

Marca: Invitrogen™ RP90382

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TGF-alpha is an EGF-related polypeptide growth factor that signals through the EGF receptor, and stimulates the proliferation of a wide range of epidermal and epithelial cells. It is produced by monocytes, keratinocytes, and various tumor cells. TGF-alpha induces anchorage-independence transformation in cultured cells. Human, murine and rat TGF-alpha are cross-species reactive. TGFalpha (aa 50) is a growth factor with 33% homology to EGF, binds to EGFR, activates tyrosine phosphorylation of the receptor, and stimulates cell proliferation. It plays a role in tumor initiation by inducing the reversible transformed phenotype.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P01135
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 7039
Nombre Human TGF alpha (aa 23-97) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen EGF-like TGF; ETGF; I79_019067; LOC100009150; Protransforming growth factor alpha; RATTGFAA; TFGA; TGF a; TGF type 1; TGF a; TGFA; TGFAA; TGFalpha; TGF-alpha; TGFa; Transforming growth factor; Transforming growth factor alpha; transforming growth factor, alpha; transforming growth factor-alpha; wa1; wa-1; waved 1
Nombre común TGF alpha
Símbolo de gen TGFA
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQ
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado