missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30195167

Invitrogen™ Human TCF2 (aa 23-132) Control Fragment Recombinant Protein

Código de producto. 30195167
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30195167 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30195167 Proveedor Invitrogen™ N.º de proveedor RP100696

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51682 (PA5-51682. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hepatocyte Nuclear Factor 1 (HNF1, Homeoprotein LFB3, Transcription factor 2, TCF2, Variant hepatic nuclear factor) is a member of the homeodomain-containing superfamily of transcription factors. It is a liver-specific factor of the homeobox-containing basic helix-turn-helix family. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. HNF1has been shown to function in nephron development and regulates development of the embryonic pancreas. Mutations in the gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of the gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P35680
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 6928
Nombre Human TCF2 (aa 23-132) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen FJHN; Hepatocyte nuclear factor 1-beta; hepatocyte nuclear factor-1 beta; HNF1 beta A; HNF1 homeobox B; HNF1B; Hnf-1 b; Hnf1beta; HNF-1 Beta; HNF-1-beta; HNF2; homeoprotein LFB3; HPC11; LFB3; LF-B3; MODY5; Tcf2; Tcf-2; Transcription factor 2; Transcription factor 2 hepatic; Transcription factor 2 hepatic; LF-B3; variant hepatic nuclear factor; transcription factor 2, hepatic; Transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor; variant hepatic nuclear factor 1; vHNF1
Nombre común TCF2
Símbolo de gen HNF1B
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.