missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TAF1 (aa 1748-1870) Control Fragment Recombinant Protein

Código de producto. 30197118
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30197118 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30197118

Marca: Invitrogen™ RP91898

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81918 (PA5-81918. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

3-Phosphoglycerate dehydrogenase (PHGDH; EC 1.1.1.95) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P21675
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 6872
Nombre Human TAF1 (aa 1748-1870) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AU015687; B430306D02Rik; BA2R; Ccg1; Ccg-1; CCGS; Cell cycle gene 1 protein; cell cycle, G1 phase defect; complementation of cell cycle block, G1-to-S; DYT3; DYT3/TAF1; KAT4; MRXS33; NSCL2; N-TAF1; OF; P250; RGD1562050; TAF(II)250; TAF1; TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor; TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250 kDa; TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, neuron specific isoform; Taf2a; TAFII250; TAFII-250; TATA box binding protein associated factor 1; TATA-box binding protein associated factor 1; TBP-associated factor 250 kDa; transcription factor TFIID p250 polypeptide; transcription initiation factor TFIID 250 kDa subunit; Transcription initiation factor TFIID subunit 1; XDP
Nombre común TAF1
Símbolo de gen TAF1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.