missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30203517

Invitrogen™ Human TACC3 (aa 182-291) Control Fragment Recombinant Protein

Código de producto. 30203517
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30203517

Marca: Invitrogen™ RP88724

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54560 (PA5-54560. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TACC1 is located on 8p11 chromosomal region that is amplified in approximately 15% of all breast tumor samples. The short arm of chromosome 8 also contains FGFR1 whose expression is enhanced in most breast cancer tumors. TACC family members, TACC1, TACC2, and TACC3, map very closely to the corresponding FGFR1, FGFR2, FGFR3 genes on chromosomes 4,8, and 10. Subsequently, since they are phylogenetically related, it is proposed that TACC and FGFR have similar roles in cell growth and differentiation. Also, TACC1 contains a conserved C-terminal region as in the Drosophila homolog, D-TACC. It has been shown that D-TACC is necessary for normal spindle function, and the mammalian TACC proteins appears to interact with centrosomes and microtubules in a similar manner.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9Y6A5
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 10460
Nombre Human TACC3 (aa 182-291) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Aint; Arnt interacting protein; ARNT-interacting protein; C86661; ERIC1; ERIC-1; Tacc3; transforming acidic coiled coil 3; transforming acidic coiled-coil containing protein 3; transforming acidic coiled-coil-containing protein 3; transforming, acidic coiled-coil containing protein 3
Nombre común TACC3
Símbolo de gen TACC3
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia VEENLSSYSLDRRVTPASETLEDPCRTESQHKAETPHGAEEECKAETPHGAEEECRHGGVCAPAAVATSPPGAIPKEACGGAPLQGLPGEALGCPAGVGTPVPADGTQTL
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado