Learn More
Invitrogen™ Human STING Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP102809
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83404 (PA5-83404. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
STING is a 379 amino acid containing signaling protein that acts as an important component of innate immune signaling. This signaling protein is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon (IFN-alpha and IFN-beta) and exert a potent anti-viral state following expression. STING may have translocon function, the translocon possibly being able to influence the induction of type I interferons and is also involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II) thus facilitating the detection of intracellular viral RNA species as well as B-form DNA and mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway. Generally seen in endoplasmic reticulum membrane, cell membrane and mitochondrion outer membrane, it is ubiquitously expressed in most of tissues.
Especificaciones
Q86WV6 | |
Blocking Assay, Control | |
340061 | |
100 μL | |
2610307O08Rik; endoplasmic reticulum IFN stimulator; endoplasmic reticulum interferon stimulator; ERIS; hMITA; hSTING; hypothetical LOC533661; mediator of IRF3 activation; Mita; mitochondrial mediator of IRF3 activation; mitochondrial transmembrane protein 173; MMITA; Mpys; mSTING; NET23; N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner; poSTING; RGD1562552; rSTING; SAVI; Stimulator of interferon genes protein; stimulator of interferon response cGAMP interactor 1; STING; STING1; tm173; Tmem173; Transmembrane protein 173 | |
TMEM173 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human STING Control Fragment | |
RUO | |
STING | |
Unconjugated | |
Recombinant | |
YSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCQTLEDILADAPESQNNCR | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Certificados
Se requiere un número de lote para mostrar resultados para certificados. Para encontrar su número de lote en pedidos anteriores, utilice el área de estado de pedidos.
Número de lote | Tipo de certificado | Fecha | Catalog Number |
---|---|---|---|
000050452 | Certificado de análisis | 14/03/2025 |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.