missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human STING Control Fragment Recombinant Protein

Código de producto. 30198751
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30198751 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30198751

Marca: Invitrogen™ RP102809

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83404 (PA5-83404. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STING is a 379 amino acid containing signaling protein that acts as an important component of innate immune signaling. This signaling protein is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon (IFN-alpha and IFN-beta) and exert a potent anti-viral state following expression. STING may have translocon function, the translocon possibly being able to influence the induction of type I interferons and is also involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II) thus facilitating the detection of intracellular viral RNA species as well as B-form DNA and mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway. Generally seen in endoplasmic reticulum membrane, cell membrane and mitochondrion outer membrane, it is ubiquitously expressed in most of tissues.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q86WV6
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 340061
Nombre Human STING Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2610307O08Rik; endoplasmic reticulum IFN stimulator; endoplasmic reticulum interferon stimulator; ERIS; hMITA; hSTING; hypothetical LOC533661; mediator of IRF3 activation; Mita; mitochondrial mediator of IRF3 activation; mitochondrial transmembrane protein 173; MMITA; Mpys; mSTING; NET23; N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner; poSTING; RGD1562552; rSTING; SAVI; Stimulator of interferon genes protein; stimulator of interferon response cGAMP interactor 1; STING; STING1; tm173; Tmem173; Transmembrane protein 173
Nombre común STING
Símbolo de gen TMEM173
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia YSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCQTLEDILADAPESQNNCR
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.