missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30181294

Invitrogen™ Human SPTLC3 (aa 167-227) Control Fragment Recombinant Protein

Código de producto. 30181294
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30181294 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30181294

Marca: Invitrogen™ RP99457

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60657 (PA5-60657. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Serine palmitoyltransferase (SPT). The heterodimer formed with LCB1/SPTLC1 constitutes the catalytic core. The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC3-SPTSSA isozyme uses both C14-CoA and C16-CoA as substrates, while the SPTLC1-SPTLC3-SPTSSB has the ability to use a broader range of acyl-CoAs without apparent preference.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9NUV7
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 55304
Nombre Human SPTLC3 (aa 167-227) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen C130053K05Rik; C20orf38; dJ718P11; dJ718P11.1; hLCB2b; LCB 3; LCB2b; LCB3; long chain base biosynthesis protein 2 b; Long chain base biosynthesis protein 3; serine palmitoyltransferase 3; serine palmitoyltransferase long chain base subunit 3; serine palmitoyltransferase, long chain base subunit 2-like (aminotransferase 2); serine palmitoyltransferase, long chain base subunit 3; serine-palmitoyl-CoA transferase 3; Serine-palmityl-CoA transferase 3; SPT 3; SPT3; SPTLC2L; SPTLC3
Nombre común SPTLC3
Símbolo de gen SPTLC3
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVF
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.