missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Spectrin beta-4 (aa 2099-2196) Control Fragment Recombinant Protein

Código de producto. 30197308
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30197308

Marca: Invitrogen™ RP104041

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62972 (PA5-62972. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Spectrin is the major constituent of the cytoskeletal network underlying the erthrocyte plasma membrane and determines cell shape, arrangement of transmembrane proteins and organization of organelles. It is expressed at very low levels in many tissues, with the strongest expression in the cerebellum, spinal cord, stomach, pituitary gland, liver, pancreas, salivary gland, kidney, bladder and heart. Spectrin beta 4 is a non-erythrocyte member, and is expressed in the brain and pancreatic islets and localisted to the nuclear matrix, cytoplasmic vesicles and PML nuclear bodies. Beta4 spectrins are also essential for membrane stability and the molecular organization of the nodes of Ranvier.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9H254
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 57731
Nombre Human Spectrin beta-4 (aa 2099-2196) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1700022P15Rik; 5830426A08Rik; beta-IV spectrin; beta-spectrin 4; dyn; EMBL BAB83243.1; KIAA1642; lnd; lumbosacral neuroaxonal dystrophy; neuroaxonal dystrophy; nmf261; nmf379; quivering; qv; ROSA62; SpbIV; spectrin beta 4; spectrin beta chain, brain 3; spectrin beta chain, non-erythrocytic 4; spectrin beta, non-erythrocytic 4; spectrin, beta, non-erythrocytic 4; spectrin, non-erythroid beta chain 3; SPNB4; SPTBN3; SPTBN4
Nombre común Spectrin beta-4
Símbolo de gen SPTBN4
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia AWEERFSSLRRLTTIEKIKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLP
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado