Learn More
Invitrogen™ Human SP3 (aa 492-588) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP108340
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111039 (PA5-111039. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted. A related pseudogene has been identified on chromosome 13.
Especificaciones
Q02447 | |
Blocking Assay, Control | |
6670 | |
100 μL | |
D130027J01Rik; DKFZp686O1631; GC-binding transcription factor Sp3; SP3; Sp3 transcription factor; specificity protein 3; SPR1; SPR-1; SPR2; SPR-2; trans-acting transcription factor 3; transcription factor Sp3 | |
SP3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human SP3 (aa 492-588) Control Fragment | |
RUO | |
SP3 | |
Unconjugated | |
Recombinant | |
VQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQ | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.